HPLC Verified ≥99% Purity•GMP-Compliant Manufacturing•COA Per Batch Available•Cold Chain Shipping Worldwide•Research Grade Peptides•Custom Synthesis Available•HPLC Verified ≥99% Purity•GMP-Compliant Manufacturing•COA Per Batch Available•Cold Chain Shipping Worldwide•Research Grade Peptides•Custom Synthesis Available
LiyuPepLabs LogoLiyuPepLabs
GDF-8 (Myostatin)

GDF-8 (Myostatin)

Product images are for illustrative purposes only. The actual product may vary.

≥99%Research Compounds
research-use

Unit Price

$230.00

Total: $230.00

GDF-8 listed as a research-use product. Chemical identity, specifications, and analytical data should be verified against the supplier's current COA and product documentation.

Molecular Weight
24.8 kDa (mature homodimer); 12.4 kDa per monomer
Sequence
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Solubility
Soluble in aqueous acidic solution; recombinant protein is commonly reconstituted in 20 mM HCl at 0.1 mg/mL
Storage
Lyophilized protein: store at -20°C; for long-term storage, -20°C to -80°C; after reconstitution, store at 4°C for short-term use or aliquot and store frozen; avoid repeated freeze-thaw cycles, For details, please consult customer service

Research Applications

  • Research use only

Research Notes

Exact CAS, molecular formula, molecular weight, sequence, purity, and handling conditions are not inferred here when the source list does not provide them.